SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322689138|ref|YP_004208872.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322689138|ref|YP_004208872.1|
Domain Number 1 Region: 14-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.89e-84
Family AAT-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322689138|ref|YP_004208872.1|
Sequence length 396
Comment aspartate aminotransferase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MINEEYKAMLGGKSVIRELSEYATSRGAEIGYQNVFDYSLGNPSVPAPKSFTDAMVDLYE
NGDPVAIHGYSPSLGIPSVKDAIAENLNERFGMAYTGNHIFPTTGAAGALSHAMRAVTKP
GDEIITFAPYFPEYQPYVKGAGAKLTIVPADTENFQINFDAFEAALNPNVQVVLINTPNN
PSGAVYSADTLKRLAAILTAKQVEYGHDIFLISDEPYREIVFDGATQPYPASFYANSLTC
YSWSKSLSLPGERIGYVAVNPTATDADLLVPMMGQISRGTGHNCPPSSIQLGVAKVIDQT
ADLNVYETNMNLLYDALTGIGFDVVRPGGTFYIFPKALEDDAVAFCMKAKEYDLILVPSD
SFGVPGYFRMAYCIDTEKVKRSIPVFEKFAHEVYGL
Download sequence
Identical sequences A0A083WY12 A0A083XWK3 A0A087AZ26 A0A0A0UAK8 A0A0M5L6A3 B3DS49 C2GX57 C5EB03 D6DDG7 E5XZY3 E8MI96 E8MTK0 F8AQI8 I3B3Z9 Q8G666 R5NGS1 T2I133 V6Y0Z2
gi|384201586|ref|YP_005587333.1| gi|322691021|ref|YP_004220591.1| gi|312132789|ref|YP_004000128.1| gi|23465359|ref|NP_695962.1| gi|322689138|ref|YP_004208872.1| NP_695962.1.18194 WP_007052235.1.10685 WP_007052235.1.11999 WP_007052235.1.12982 WP_007052235.1.13888 WP_007052235.1.15467 WP_007052235.1.19800 WP_007052235.1.22978 WP_007052235.1.23590 WP_007052235.1.26381 WP_007052235.1.29295 WP_007052235.1.30534 WP_007052235.1.31269 WP_007052235.1.35161 WP_007052235.1.35419 WP_007052235.1.37185 WP_007052235.1.37587 WP_007052235.1.41489 WP_007052235.1.42164 WP_007052235.1.46548 WP_007052235.1.49187 WP_007052235.1.49359 WP_007052235.1.49397 WP_007052235.1.51274 WP_007052235.1.51719 WP_007052235.1.51739 WP_007052235.1.54925 WP_007052235.1.55246 WP_007052235.1.55576 WP_007052235.1.56191 WP_007052235.1.59950 WP_007052235.1.61280 WP_007052235.1.68920 WP_007052235.1.70526 WP_007052235.1.76144 WP_007052235.1.76173 WP_007052235.1.76388 WP_007052235.1.84493 WP_007052235.1.86174 WP_007052235.1.89707 WP_007052235.1.94003 WP_007052235.1.94251 WP_007052235.1.94713 WP_007052235.1.96408 WP_007052235.1.98069 WP_007052235.1.98685 WP_007052235.1.99105 WP_007052235.1.99722 gi|479135730|ref|YP_007767530.1| gi|189439385|ref|YP_001954466.1| 205913.BLD_0522 206672.BL0783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]