SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322689447|ref|YP_004209181.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322689447|ref|YP_004209181.1|
Domain Number 1 Region: 14-409
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.26e-92
Family Cystathionine synthase-like 0.00000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|322689447|ref|YP_004209181.1|
Sequence length 415
Comment pyridoxal-phosphate-dependent aminotransferase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MADTPNASGEPGELYLDAAATESVSPAVIEAMTPFLTEAYANPASVHQPGKTAARALDAA
RASFAAALGARPDDVIFTSGGTESDNLAIKGIAMARMRKLGLRPVCGFAEADGKQPANCR
PRIIISAIEHPAVAQSAAWLHEWFGFEVVRIPVDAQAHLDLDALERELDGEASERTTMVS
TMLANNEVGTVEPVEELVRIAHAHGVPIHVDAVQAAGQIPIRFRDWDVDALSVSGHKFGT
PKGLGALLVRGRTPIEPVLSGGGQERGLRSGTQNVAGAVALAIGLNESNARMQAQYRELV
ASRDMLIDAVRRVAPRADLTGDPERRLPGHASFIFPGVTGEALLVDLDARGIAASSGSAC
AIGRHEIPATLLAMGLEPSIAKSALRMTFRKPLTREQVERISLAIEESYTDLTRH
Download sequence
Identical sequences A0A083XAJ4 A0A083XSB5 A0A0A0UIF2 A0A0A1GSJ4 A0A0L7B494 A0A0M0VNZ6 A0A0M4MLE5 B3DQU4 C2GYE2 D6DCW0 E8MDW6 E8MUF9 I3B6G1 I3BHB5 R5NE54 T2I1N5 V6XX00
gi|322691415|ref|YP_004220985.1| 205913.BLD_0244 gi|189439107|ref|YP_001954188.1| gi|322689447|ref|YP_004209181.1| WP_007054451.1.12982 WP_007054451.1.13888 WP_007054451.1.15312 WP_007054451.1.15467 WP_007054451.1.16764 WP_007054451.1.19800 WP_007054451.1.22978 WP_007054451.1.26381 WP_007054451.1.29295 WP_007054451.1.30534 WP_007054451.1.35161 WP_007054451.1.35419 WP_007054451.1.36525 WP_007054451.1.41489 WP_007054451.1.42164 WP_007054451.1.46548 WP_007054451.1.4820 WP_007054451.1.49359 WP_007054451.1.49397 WP_007054451.1.50584 WP_007054451.1.50944 WP_007054451.1.51653 WP_007054451.1.51739 WP_007054451.1.54925 WP_007054451.1.55246 WP_007054451.1.55576 WP_007054451.1.56191 WP_007054451.1.61280 WP_007054451.1.68920 WP_007054451.1.76203 WP_007054451.1.76388 WP_007054451.1.80315 WP_007054451.1.8287 WP_007054451.1.83561 WP_007054451.1.84493 WP_007054451.1.86174 WP_007054451.1.89707 WP_007054451.1.94003 WP_007054451.1.94251 WP_007054451.1.94713 WP_007054451.1.96408 WP_007054451.1.98069 WP_007054451.1.98685 gi|479135523|ref|YP_007767323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]