SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322689534|ref|YP_004209268.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322689534|ref|YP_004209268.1|
Domain Number 1 Region: 29-380
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.03e-68
Family AAT-like 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|322689534|ref|YP_004209268.1|
Sequence length 386
Comment histidinol-phosphate aminotransferase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MSSIPANLPLRNDLIGEEPYGAPQLDVPVCLNVNENPYAPDPAVCDTIAKRVREIAPTLN
RYPDREHIELRQAFSDYLARESGTRLDVDELWGANGSNEIMLQLFQAFGGPGRTALGADP
TYSMYPEYARDTFTGWKLAHRNADFTLNVDKVLEAIAEVKPSMVLLTSPNNPTGTPLPME
DIERILAACETAEVVGAGEGVHPILVIDEAYVEFRKPGTPSAVSLIKDHPNLAVSRTMSK
AFAFAGARVGYLAASKGIIDCVRIVRMPYHLSAVTQAAALAAFEHTDEQLSRVEHLRETR
EATAAWLKEQTYKDQPLEVAESGSNFLLFGGHFDKREAIFDELLKRGVLIRVVGPDGWLR
VCMGTDEEMETFRNALVEVLRIVEAA
Download sequence
Identical sequences A0A083XSK1 A0A087AU14 A0A0A1GU38 C2GY54 C5EBS2 E5Y111 E8ME42 E8MUP6 F8AP55 I3BMY2 T2I1L0 V6XXE1
WP_007052518.1.10685 WP_007052518.1.11999 WP_007052518.1.12982 WP_007052518.1.13888 WP_007052518.1.15467 WP_007052518.1.19800 WP_007052518.1.23590 WP_007052518.1.26381 WP_007052518.1.29295 WP_007052518.1.30534 WP_007052518.1.31269 WP_007052518.1.35161 WP_007052518.1.35419 WP_007052518.1.37185 WP_007052518.1.41489 WP_007052518.1.46548 WP_007052518.1.4820 WP_007052518.1.49187 WP_007052518.1.49359 WP_007052518.1.49397 WP_007052518.1.50584 WP_007052518.1.50944 WP_007052518.1.51274 WP_007052518.1.51653 WP_007052518.1.51719 WP_007052518.1.51739 WP_007052518.1.54925 WP_007052518.1.55246 WP_007052518.1.55537 WP_007052518.1.55576 WP_007052518.1.56191 WP_007052518.1.59461 WP_007052518.1.59950 WP_007052518.1.62466 WP_007052518.1.68920 WP_007052518.1.70526 WP_007052518.1.76144 WP_007052518.1.76173 WP_007052518.1.80315 WP_007052518.1.8287 WP_007052518.1.83561 WP_007052518.1.84493 WP_007052518.1.94003 WP_007052518.1.94251 WP_007052518.1.94713 WP_007052518.1.96408 WP_007052518.1.98685 WP_007052518.1.99722 gi|322691491|ref|YP_004221061.1| gi|384201212|ref|YP_005586959.1| gi|312132456|ref|YP_003999795.1| gi|322689534|ref|YP_004209268.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]