SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322689714|ref|YP_004209448.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322689714|ref|YP_004209448.1|
Domain Number 1 Region: 33-399
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.83e-78
Family Cystathionine synthase-like 0.0000575
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|322689714|ref|YP_004209448.1|
Sequence length 403
Comment aminotransferase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MTYDFTSIMDRHGKDAIAVDGLGTDLGFAPDPPRDGFDVIPMWVADMNFPTVPTVPQAII
ERAQHPVYGYFSPTDDYYNSIIDWQSTRNGVTGLTSEAIGYENGVLGGVISTLTAFAAPG
DSVLLHSPTYIGFTMCIENNGYRIVHSPLKLDEHGVWRMDYENMDKKLKEHHIHVAVFCS
PHNPCGRVWERWEIEKAMEVYKANDCVVISDEIWSDLTLGNHQHIPTQSVSEDARNRTAA
FYAPSKTFNLAGLVGSYHIIYNPMLRDRIVAKGSKSHYNEMNVLSMHALIGAYKPEGHEW
LDELKEVLTGNVDYAYDYITKHFQGVSLAKPEGTYMLLLDCEQWCKAHGLTLAELEKRGW
DVGVDWQDGSMFQAPYSIRVNLALPLSRIKEAMRRLDQYVFNA
Download sequence
Identical sequences A0A133LV48 E8MV76
gi|322689714|ref|YP_004209448.1| WP_015713794.1.15467 WP_015713794.1.99105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]