SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322689854|ref|YP_004209588.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322689854|ref|YP_004209588.1|
Domain Number 1 Region: 18-379
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.31e-74
Family GABA-aminotransferase-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322689854|ref|YP_004209588.1|
Sequence length 380
Comment phosphoserine aminotransferase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MTITLSIPESLKPEDGRFGSGPSKIRPEQIAALDAGATTLLGTSHRQAPVKQLVASIREG
LREFFHLPEGYEVALGNGGASAFWEIACASLITRRAAFGTYGSFSAKFAASAANAPFLED
PVLFPGEPGTYRLPELTEGVDTYCWAHNETSTGVAAPIRRVAGSREAGALTVIDGTSAAG
ALPVDISQTDVYYFSPQKAFGADGGLWVAILSPEAIDRAAGVESSAHLEGAHRWVPPFLS
LTTALNNSRKDQTLNTPAVATLIMMENQIRWLNNNGGLAWATTRCAKSASILYSWAERSE
YAAPFVVDADARSNAVVTIDLDERVQASQVLSILRENGIVDAAGYRKLGRNQLRVGVFPS
VEPADVMAFTKCVDYVVEHL
Download sequence
Identical sequences A0A083WYX2 A0A083XXY1 A0A087AUW3 A0A0A0UCV0 A0A0A1GQG4 B3DQJ0 C2GVC9 C5EBA0 D6DBZ8 E8MEZ4 E8MVL6 I3BEB8 Q8G3U5 R5NH10 T2I335
gi|23466207|ref|NP_696810.1| gi|322691793|ref|YP_004221363.1| gi|479135211|ref|YP_007767011.1| 205913.BLD_1783 206672.BL1660 gi|312133949|ref|YP_004001288.1| gi|322689854|ref|YP_004209588.1| gi|189440645|ref|YP_001955726.1| NP_696810.1.18194 WP_007052351.1.10685 WP_007052351.1.11999 WP_007052351.1.12982 WP_007052351.1.13888 WP_007052351.1.15467 WP_007052351.1.22978 WP_007052351.1.23590 WP_007052351.1.26381 WP_007052351.1.35161 WP_007052351.1.37185 WP_007052351.1.41489 WP_007052351.1.42164 WP_007052351.1.46548 WP_007052351.1.49359 WP_007052351.1.49397 WP_007052351.1.50584 WP_007052351.1.50944 WP_007052351.1.51274 WP_007052351.1.51653 WP_007052351.1.51719 WP_007052351.1.54925 WP_007052351.1.55537 WP_007052351.1.56191 WP_007052351.1.59461 WP_007052351.1.59950 WP_007052351.1.61280 WP_007052351.1.62466 WP_007052351.1.68920 WP_007052351.1.76144 WP_007052351.1.76388 WP_007052351.1.80315 WP_007052351.1.8287 WP_007052351.1.83561 WP_007052351.1.84493 WP_007052351.1.86174 WP_007052351.1.89707 WP_007052351.1.94003 WP_007052351.1.96408 WP_007052351.1.98685 WP_007052351.1.99722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]