SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322689944|ref|YP_004209678.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322689944|ref|YP_004209678.1|
Domain Number 1 Region: 20-208,251-409
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.07e-65
Family AAT-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|322689944|ref|YP_004209678.1|
Sequence length 411
Comment aminotransferase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MGFHAYSSPYDWSRIAGFKATAKTVPGGMIDLSVGSPVDPVPSSVQQALVAGADAPNAHG
YPVTAGTADLKAAIDTWFRELRGVDLKSINAAAVPTVGSKEAVALMASLLHLGEGDVVVQ
PAVSYPTYEIGTQLAGATVVKVDDVTDVDSWVNIPNVKAIWINSPCNPSGEVISADWLTD
IVAAARRIGAVVLSDECYALMDWRSVRRNTAASSAPAASASAASVPAAPVAESNEPASDT
AFSLSATPCALNPHVCEGSAAGILVLYSLSKQSNMAGYRTALIAGDYRLVKEMAEYRKQI
GQIIPGPVQAAMAAGLKDTAAVHEQWRRYRRRLSALVDALKAYGYSAQMPSGALYVWVKA
KSGDCWADMAELAKIGIIPSPGEFYGAPAYLRFSATATDEAIRSACERLTA
Download sequence
Identical sequences A0A083WYN3 A0A083XXN7 A0A0A1GQM8 A0A0M0VJK1 B3DPZ1 C5ED72 D6DC77 E5XZM4 E8MF86 E8MVV6 I3AZL4 T2I320
gi|322689944|ref|YP_004209678.1| 205913.BLD_1685 gi|322691885|ref|YP_004221455.1| gi|479135290|ref|YP_007767090.1| gi|189440547|ref|YP_001955628.1| WP_007053017.1.12982 WP_007053017.1.15467 WP_007053017.1.16764 WP_007053017.1.29295 WP_007053017.1.35161 WP_007053017.1.35419 WP_007053017.1.37185 WP_007053017.1.37587 WP_007053017.1.41489 WP_007053017.1.49187 WP_007053017.1.49359 WP_007053017.1.50584 WP_007053017.1.50944 WP_007053017.1.51274 WP_007053017.1.51739 WP_007053017.1.54925 WP_007053017.1.55246 WP_007053017.1.55537 WP_007053017.1.55576 WP_007053017.1.56191 WP_007053017.1.59461 WP_007053017.1.59950 WP_007053017.1.61280 WP_007053017.1.62466 WP_007053017.1.68920 WP_007053017.1.76388 WP_007053017.1.80315 WP_007053017.1.84493 WP_007053017.1.86174 WP_007053017.1.89707 WP_007053017.1.94003 WP_007053017.1.96408 WP_007053017.1.98069 WP_007053017.1.98685 WP_007053017.1.99105 WP_007053017.1.99722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]