SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322689949|ref|YP_004209683.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322689949|ref|YP_004209683.1|
Domain Number 1 Region: 51-128
Classification Level Classification E-value
Superfamily PLP-dependent transferases 0.0000000000131
Family Cystathionine synthase-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|322689949|ref|YP_004209683.1|
Sequence length 130
Comment gamma lyase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MASDLVHHGQSFDDQPLGFGTLAIHLGNGVDAETGAIRRPITLANAYALPYDPSALAIAK
HLESLDVVRFVAYPGLESHLHHKVAASQLARPDSGFGGVLSFGLDTDHDGHTRFVSKLNV
ITSAVSLGHD
Download sequence
Identical sequences A0A0A1GQN4 E8MVW1 T2I324
WP_015713859.1.15467 WP_015713859.1.23590 WP_015713859.1.49187 WP_015713859.1.49359 WP_015713859.1.50944 WP_015713859.1.51274 WP_015713859.1.55537 gi|322689949|ref|YP_004209683.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]