SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|322689999|ref|YP_004209733.1| from Bifidobacterium longum subsp. infantis 157F

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|322689999|ref|YP_004209733.1|
Domain Number 1 Region: 6-400
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.67e-111
Family AAT-like 0.00000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|322689999|ref|YP_004209733.1|
Sequence length 401
Comment aspartate aminotransferase [Bifidobacterium longum subsp. infantis 157F]
Sequence
MAQWQTLSDRINTVAPSATLAVDSKAKAMKAAGLDVVGFGAGEPNFPTPANVVKAAADAC
LDPKNYKYTPTPGLPELREAIAAKMLRDSGYEVNADQVVVTNGGKQAVYESFQILLNDGD
EVIIPAPYWTSYPEAVKLAGGVPVEVFAGADVNFEPSLEALEAARTEHTKAIIVNSPNNP
TGAVWKPETVEAIGRWAVEHHIWVISDEIYEHLNYDDAHTTYIGAAVPECRGQLLVLNGV
AKTYAMPGWRVGWMVAPLEVAKAAAKLQGHMTSNVANISQRAALAAVAGPLDEVHEMRKA
FDARRRAIVTALNDIEGVNCPTPTGAFYAFADIAALLGKPLGPKGTVSDTSADFAAALLD
EAHVAAVPGEAFGAPGYLRFSYALADEDLAEGMRRFKEWAN
Download sequence
Identical sequences E8MW11
WP_015713883.1.15467 gi|322689999|ref|YP_004209733.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]