SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387131826|ref|YP_006297799.1| from Prevotella intermedia 17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387131826|ref|YP_006297799.1|
Domain Number 1 Region: 302-536
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.64e-34
Family ABC transporter ATPase domain-like 0.00053
Further Details:      
 
Domain Number 2 Region: 24-297
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.49e-20
Family DNA repair protein MutS, domain III 0.016
Further Details:      
 
Domain Number 3 Region: 802-876
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000085
Family Smr domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387131826|ref|YP_006297799.1|
Sequence length 877
Comment Smr domain protein [Prevotella intermedia 17]
Sequence
MIYPNNFEQKIGFNEIRTLLHEHCLSTLGREQVDGMEFSTDTAQVNRWLAEVREFRRIQE
GAEPFPLDNVFDVRASVARIRLEGTYMEESELFDLKRSLETIIAIVKFLSAGDELPNGDI
QHTYPALYALADGVATFPILVQRISQIIDKFGKMRDSASPGLLQIRRELAHMESSISRTL
NRILHSAQSEGVVDRDVTPTMRDGRLVIPVAPGMKRKISGIVHDESATGKTVFIEPTEVV
EANNKIRELENEERKEIIRILREFAKLVRPHIREILDSYHFLALIDFIRAKAELARMFKA
IEPEVGTEPYVDFIRAIHPLLQLSLSKKQRTAENSDAPLAVVPLDIQLTKEKHLLIISGP
NAGGKSVCLKTVGLLQYMLQCGLSIPVSERSTAGTFRNLMIDIGDEQSIENDLSTYSSHL
MNMKNMMKQADRHTLILIDEFGTGTEPQIGGAIAESVLRQFWKKQAWAVITTHYQNLKHF
AEDHKGVVNGAMLYDRHEMRPLFQLAIGRPGSSFAIEIARKTGIPEEVISDASVIVGSDY
IQSDKYLQDIVRDKRYWETKRQTVHSHEKELERTIAKYEKEMEELRQSRKEIIKKAKAEA
EEIIRESNKRIENVIREIREQQAEKEATKRLRQELAEYEEAMLNDSMAALNCKSKTKAKK
AANKQAMREDGLMTDEELKAKIEKIKNRKERHERRLQEKEERKQNAAEALKAATQKRAAN
RPIGVGDTVRIKGLTSIGEVESTDGKQAMVIFGGMRTKMAVSRLERADDAAVKESQKQFT
AYNYSRQTRETIDQHRNQFKQEIDVRGMRADEALNQVQYFIDDAILVGVSQVRILHGKGN
GILRTMIRQYLNSVPNVKSCRDEHVQFGGAGITVVEL
Download sequence
Identical sequences A0A1P8JNW8 I1YRT1
WP_014708492.1.25991 WP_014708492.1.64095 WP_014708492.1.73680 gi|387131826|ref|YP_006297799.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]