SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387132029|ref|YP_006298002.1| from Prevotella intermedia 17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387132029|ref|YP_006298002.1|
Domain Number 1 Region: 118-259
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 3.27e-28
Family PA2201 C-terminal domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387132029|ref|YP_006298002.1|
Sequence length 259
Comment PF08929 domain protein [Prevotella intermedia 17]
Sequence
MKLRENINSEENLLAELEKNYQRIKEYSKKIVMLTDDEAKGIQRYRNPNLYIIKLERWSI
LEAYFFIIKAKYTLGYPVSELLDDYEKGLQVFSDYWASLTDEDFTYGTKFQPFYSALRYE
KLIGYIALSFLLNVSEESFKTIIKIRDRIPTPDILLDFLLSHKDGRTVCQERIRGNLYKG
LASILQKGKDNIAVADIKKYLMKQWHKDYIRTGNMYTHTEYFHVGYWSFETGAVVKLLNL
DDSSLKGVPYYPYDLVHYQ
Download sequence
Identical sequences A0A1P8JNA4 I1YRL0
WP_014708692.1.25991 WP_014708692.1.64095 WP_014708692.1.73680 gi|387132029|ref|YP_006298002.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]