SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387132511|ref|YP_006298483.1| from Prevotella intermedia 17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387132511|ref|YP_006298483.1|
Domain Number 1 Region: 318-615
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.62e-82
Family DNA repair protein MutS, domain III 0.00000276
Further Details:      
 
Domain Number 2 Region: 617-852
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.55e-57
Family ABC transporter ATPase domain-like 0.00000121
Further Details:      
 
Domain Number 3 Region: 164-317
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 6.15e-37
Family DNA repair protein MutS, domain II 0.00043
Further Details:      
 
Domain Number 4 Region: 39-163
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.62e-35
Family DNA repair protein MutS, domain I 0.0000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387132511|ref|YP_006298483.1|
Sequence length 924
Comment DNA mismatch repair protein MutS [Prevotella intermedia 17]
Sequence
MDKAQINWLSFAQYAENSYFCISRITTTKGKKGKNNMAKDNKGLTPMMRQFFSMKEKHPD
ALMLFRCGDFYETYCDDAIEASKILGITLTRRNNGAAAGDEMAGFPHHALDTFLPKLIRA
GKRVAICDQLEDPKKKREALKGKRGLSAEDKMVRRGITELVTPGVAMGDNVLNYKENNFL
AAVHFGKGSCGVSFLDISTGEFLTGEGTFDYVEKLIGNFSPKEVLYDRARKSDFERHFGT
RLCVYEMEDWVFTDLSARQKLLKHFGTKNLKGFGVDHLNNGVIAAGAIMQYLELTQHTNI
NHITSLARIEEEKYVRLDRFTIRSLELVAPMQEDGSSLLNVVDRTITPMGGRMLHRWLVF
PLKDVKPINERLDIVEYYFREPDFRQCLNDQLHRMGDLERIISKVAAGRVSPREVVQLKI
ALRAIQPMKTACLYANNEALKRVGEQLNLCESIRDRIEQEIKPDPPHLVAKGDVIAHGFN
AELDELRSIRDNGKQVLLDIQEKEAAQTGISSLKIGFNNVFGYYLEVRNTFKDKVPSDWI
RKQTLAQAERYITPELKEYEAKILGADEKILALEARLFNELVQDMQEFIPQIQINANLVA
RLDCLLAFANIAEENKYVRPVVDDSMVIDIKKGRHPVIETQLPLGEPYIPNDVYLDNEQQ
QIMMITGPNMAGKSALLRQTALIVLLAQIGCFVPAEGARIGLVDKVFTRVGASDNISLGE
STFMVEMTEASNILNNVTPRSLVLFDELGRGTSTYDGISIAWAIVEYLHEQPRAAARTLF
ATHYHELNEMAKNFRRIKNFNVSVKEVDGKIIFVRKLERGGSEHSFGIHVADIAGMPKSI
VKRANVVLKELEADNAQVGSVGKPSAEKLEQSREGVQLSFFQLDDPVLTQIRDEIIGLDI
NNLTPVEALNKLNEIKRIVLPNSK
Download sequence
Identical sequences I1YT44
gi|387132511|ref|YP_006298483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]