SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387132541|ref|YP_006298513.1| from Prevotella intermedia 17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387132541|ref|YP_006298513.1|
Domain Number 1 Region: 350-563
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.32e-53
Family Pseudouridine synthase RsuA/RluD 0.00028
Further Details:      
 
Weak hits

Sequence:  gi|387132541|ref|YP_006298513.1|
Domain Number - Region: 121-216
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.067
Family Arfaptin, Rac-binding fragment 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387132541|ref|YP_006298513.1|
Sequence length 565
Comment RNA pseudouridine synthase [Prevotella intermedia 17]
Sequence
MEDKCFHRLPNGNEVAVMGKAKVFPNPFFYEPSPLARIAATLLQQSLPVLKEGKMFGVLI
VEHKGELGYLQAYSGQLEGVSDDGFVPPVFDYLQPDGYFKTHEAKITALNCEIETLKQSD
DYAKAVKKLADLKVEAQQVVAEAQQAMAVAKQLRDERRKKTFVSEDEQKEMIRESQYMKA
ELHRTKKRYAALLETAEAETEEYNKKIAQLKNIRKRKSDELQRWLFSQFTFLNAKGERSD
LLSIFRNYYLQHSPQSVLATHFATMGEQATLFPPSGTGECCEPKLLQYAFAHGMRPVEMA
MFWWGEPPKTEIRQHGQFYPACNGKCKPLLTWILKGMNVAANALETESKQSIDIVYEDPD
LAVIVKPSGMLTVRGRSNRQSVETILRQRWNDNDTPIIVHRLDMATSGLLVVARNKQAHK
HLQAQFKAKTVKKRYVALLSTELLDRVELPKEGTISLPLCADVLDRPRQIVDRNKGKAAI
THYRIIGKTPLSDSRYSEAVKVKLCPVTGRTHQLRIHCAHPEGLACPILGDTLYGKCADR
LYLHAEYLEFTHPTTEKRIRFEKKI
Download sequence
Identical sequences I1YWL2
gi|387132541|ref|YP_006298513.1| WP_014709188.1.25991 WP_014709188.1.64095 WP_014709188.1.73680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]