SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387132807|ref|YP_006298779.1| from Prevotella intermedia 17

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|387132807|ref|YP_006298779.1|
Domain Number - Region: 22-65
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0077
Family FIS-like 0.092
Further Details:      
 
Domain Number - Region: 111-168
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0607
Family IMD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387132807|ref|YP_006298779.1|
Sequence length 197
Comment transcriptional regulator, RpiR domain protein [Prevotella intermedia 17]
Sequence
MERNKYSKIILSEAEQQWMRDNFCNIKNAEVAEHLGISHRTVVRIARDMGLVKHPDFTKA
MQRNASEHAAKRNRANGGNAGAKNLLIYGKAYQFKKGERQKDKMSAEAFDAMHRHIGEQR
KKIFKAEKRRVIFGLEQKTKLRVVQAPKEKICLRNGLRKKGYEIARASNEAFITAATHRS
EVMERRAISMGISFTSI
Download sequence
Identical sequences A0A1P8JJD2 I1YSM3
WP_014709435.1.25991 WP_014709435.1.64095 WP_014709435.1.73680 gi|387132807|ref|YP_006298779.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]