SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387131824|ref|YP_006297797.1| from Prevotella intermedia 17

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387131824|ref|YP_006297797.1|
Domain Number 1 Region: 8-227
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.3e-51
Family PP-loop ATPase 0.0001
Further Details:      
 
Domain Number 2 Region: 368-454
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000288
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387131824|ref|YP_006297797.1|
Sequence length 468
Comment tRNA(Ile)-lysidine synthetase [Prevotella intermedia 17]
Sequence
MLNKVKTYIDTHKLLRPDGRYIVGLSGGADSVALLLILKELGYYVEAAHCNFHLRGKESQ
RDEEYCINLCKEQDVKLHLTHFQTAEYAELHKVSIEMAARTLRYNYFEALRQDIGADAVC
VAHHRDDSVETVLLNLVRGTGLRGLMGIRPRNKYIIRPLLSCSKADIEAYLAAKEQAFVT
DSSNLVADVKRNKLRLEVVPTLKEINLSFDDTIMKMSESIGEAQKIINASLKSAFSSIVS
IENGDADALFSHLQDGTPKQTLPNLRIDIAALQSYVSPEYFLFYLLIPYGFTSPQVRSIA
SSLSSETGKEYITDSYTLLFDRKMILVSQREKTAPKPLELPETGKYICSELCSIEVKEEV
VGSNFTIPTASNEIVVDKAKVHFPLVLRRTATADRFRPFGMRGSKLVSDYLTNLKVDAVS
KRKQLVLVDGNGEIMWLVGHRSSETYRIGSTTTTALRIRFLSSKTADI
Download sequence
Identical sequences A0A1P8JNY3 I1YRM9
WP_014708490.1.25991 WP_014708490.1.64095 WP_014708490.1.73680 gi|387131824|ref|YP_006297797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]