SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320100264|ref|YP_004175856.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100264|ref|YP_004175856.1|
Domain Number 1 Region: 180-527
Classification Level Classification E-value
Superfamily HydB/Nqo4-like 1.28e-112
Family Nqo4-like 0.0000181
Further Details:      
 
Domain Number 2 Region: 26-185
Classification Level Classification E-value
Superfamily Nqo5-like 1.1e-31
Family Nqo5-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100264|ref|YP_004175856.1|
Sequence length 545
Comment NADH-ubiquinone oxidoreductase subunit 49kDa [Desulfurococcus mucosus DSM 2162]
Sequence
MMPREKAILNKYMQLAEKLGGRSLVDGDTVHIVVPRESLVKAASTLFNEHGLTHRTCVGI
DERPVNGFFSLTHVFTDDSSGLYVLLKTYMESGDPVVPSIVNEVPAADWCEQEAMDLLGI
RFEGRRRERLVLPPGWPEDAYPLRKDFQYDQKPLIHPESEKMGLTTGEEGSPIPVGPYHP
ALHEPEYFELYVDGERIVDVKYRGFHVHRGIEKLGESRMTYQQVNFLAERICGICGFEHS
TCYALAVEKAAKLDVPERAQFIRSIVLEVERIHSHLLWLGVAFHTLGYDAGFMHMWRIRE
RIMELAEMLTGSRKTYGINMVGGVRRDINEEKRRKVIEVLSELEKEYWKIIDVAVNVPQV
KKRLSGTGVLPKEWAVKLGVEGPVARASGVDKDARRDLPYAAYKHVSFKVPVYTEGDNMA
RTLVRIEETKESMSMIIQLLDMLPKGPIMLEEYEIPEGRIGVQVVEAPRGGDVHYVLTGR
GRPYRWRVRAPTYNNIPALRIMLRDQPLADAPLTIASIDPCFSCTDRVLVVRKGKGVEVL
ELNGV
Download sequence
Identical sequences E8RAG4
gi|320100264|ref|YP_004175856.1| WP_013561596.1.43297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]