SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320100277|ref|YP_004175869.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100277|ref|YP_004175869.1|
Domain Number 1 Region: 36-314
Classification Level Classification E-value
Superfamily SIS domain 5.37e-38
Family double-SIS domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320100277|ref|YP_004175869.1|
Sequence length 327
Comment bifunctional phosphoglucose/phosphomannose isomerase [Desulfurococcus mucosus DSM 2162]
Sequence
MEEMYRGWVEQLRGALMEWGRYRIHGVFNKIVVLGMGGSGIVGDFLSALSMIHGGLPVFT
LKSHVSPGFIDSGTLAISVSYSGNTRETILATMGVLGRAGGVAVVSSGGYLRELALKHGI
PFIPLPSGLAPRASLPSMLFKILGLLDSSGLRIVGRGEAEEAFAFIKDNMGGAEEEARRL
AEWINSVQGLLVIATHTPLEPLAVRGKNEFNENSKIPVKVDVAPEWMHNDIVGYEQPGIP
LRVVEVVDPSDRVGRGLVEFMHGVYVETGASTYRLALRGGTLLEKMMYGSLVLGLASCRL
ARLRGIDPLETKSIKRYKESVDSLLQA
Download sequence
Identical sequences E8RAH7
WP_013561609.1.43297 gi|320100277|ref|YP_004175869.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]