SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320100393|ref|YP_004175985.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100393|ref|YP_004175985.1|
Domain Number 1 Region: 250-605
Classification Level Classification E-value
Superfamily SIS domain 1.48e-76
Family double-SIS domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 3-226
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.29e-45
Family Class II glutamine amidotransferases 0.00008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100393|ref|YP_004175985.1|
Sequence length 606
Comment glutamine--fructose-6-phosphate transaminase [Desulfurococcus mucosus DSM 2162]
Sequence
MGGIFGVVCSTNVPRGLVVTVLRRLIYRGYDGAGAVFPVNGVLEVRKAPGHLDSVVKQVD
LEDIPSNMVLAHTRYASRGWPVYENTHPLLDCTGRIAVVGDGIIDNYEDYRARLEKEGHV
LRSRTDTEVAAHLLEKYYRIEGDWLKAVLRVGAELKGLYSLAFMVLGVDGILFVQNGQPL
VIGMGSHCVFLSSDIPSLYGLADTAYIVDDGVAGLIGLDRQVLYRISTGEQLGLQALQSK
RVKYGVEHVDKAGFPHYMLKEIYEIPEAVYRVTLSIMDKYLRLASMIIHGARDIYIVANG
SSLHAGMVATYYFNELAGISVTPVSAAEFPYSVLETVSTGSVIIAVSQSGETSDVINSVK
QAKQRGAVIVGVTNNVGSRLALESNVYLPIGAGPEIAVPATKSFSATVVAMLLLAMYSGI
YTGRQSFNEYNSLVGEVRESSKELKTILTRLDTEIATILDSMPLFNNTYVAGSGITYPIA
LEGALKLKEAALIHAEGMQLGELRHGPLTLVGRGFPVILIEPFEDSAKSLYLKVAREIAN
RDAVLLAISTESGPREGRGIYIEVPARRHLYPVIVALPLQLLAYRIGVRLNRPIDRPPGL
AKAITT
Download sequence
Identical sequences E8R7K8
gi|320100393|ref|YP_004175985.1| WP_013561725.1.43297 WP_013561725.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]