SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320100507|ref|YP_004176099.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100507|ref|YP_004176099.1|
Domain Number 1 Region: 5-157
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.29e-35
Family GHMP Kinase, N-terminal domain 0.0007
Further Details:      
 
Domain Number 2 Region: 164-307
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.44e-30
Family Galactokinase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100507|ref|YP_004176099.1|
Sequence length 317
Comment mevalonate kinase [Desulfurococcus mucosus DSM 2162]
Sequence
MPCSIAPGKVILFGEHFVVEGYPAIGLAVGLYASTCVEKGEFKIYSRQLGPIDPSSPLAK
PFLRVLEEAAREFNCGRDYTIYIDSGIPVGAGMGSSAAVNVSLTHSLLHACGAGFTREDV
SRIAYMGEVEVHGKPSGIDNTLATYGGLVYYKRGSFKRLDTLLPEGVELVVADTGVKRDT
GVVVRDVLEKRRRLGRLGGILYEAAGELVEEALAALRERDVVRLGELMTVNHGLLFSMGA
SAWVNDYLVHRMLGLGAYGAKLSGAGRGGIVIGLAEPARAQAIVEELEREGVKAYRVKPD
YEGVRLTTGSMVEPGYG
Download sequence
Identical sequences E8R7Z1
WP_013561839.1.43297 WP_013561839.1.60640 gi|320100507|ref|YP_004176099.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]