SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320100560|ref|YP_004176152.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100560|ref|YP_004176152.1|
Domain Number 1 Region: 3-130
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 5.31e-42
Family Cytidine deaminase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100560|ref|YP_004176152.1|
Sequence length 139
Comment cytidine deaminase [Desulfurococcus mucosus DSM 2162]
Sequence
MRIDVDALIKEASRVLGNSYAPYSNIHVAAAVLTSSGRVYLGVNVENASYGLTICAERSA
ISAMVAAGERDPVAVAIVTDLEDPIPPCGACRQVIAEFNPRALIVMHSTRSGRTVVRNLE
ELFPQPFTISDEAGRRDPS
Download sequence
Identical sequences E8R844
gi|320100560|ref|YP_004176152.1| WP_013561892.1.43297 WP_013561892.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]