SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320100664|ref|YP_004176256.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100664|ref|YP_004176256.1|
Domain Number 1 Region: 5-118,223-418
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 2.88e-96
Family Substrate-binding domain of HMG-CoA reductase 0.000000253
Further Details:      
 
Domain Number 2 Region: 111-217
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 1.73e-30
Family NAD-binding domain of HMG-CoA reductase 0.0000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100664|ref|YP_004176256.1|
Sequence length 426
Comment hydroxymethylglutaryl-CoA reductase, degradative [Desulfurococcus mucosus DSM 2162]
Sequence
MSSSRIPGFYKLPIHERRRIVGEWAGLTGEELETLGNLGNLPEKIADSMIENVVGGMTYP
FAVATNFLINGRERLIPMVIEETSVVAAASNAARMLRHGEGIGANAERQEMISQIHLVKV
DSPWFKAMRVIERKKEILEHAAQQDPTLLKYGGGPRDLEVRVLEHPALGGVIVVHLVVDV
RDAMGANTVNTMAEAVAPILEKITGGEARLRIVSNHAVYRVARAWAATPVDEVGGMDVAR
KIMEASILAEIDPYRAVTHNKGIMNGVIAVALATGQDHRAIEAGAHAYAARTGVYRPLSR
WEVTQDGLLAGSLEIPLQVGVVGGAVKVHPVARIALKILGVSTARELAEVMAAVGLAQNL
AALRALVTEGIQKGHMRLHARNLAIMAGATGDLIDRVAEKMVKDGRIRYDYAKELVEKAA
RGEPLD
Download sequence
Identical sequences E8R8E8
WP_013561996.1.43297 gi|320100664|ref|YP_004176256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]