SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320100688|ref|YP_004176280.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100688|ref|YP_004176280.1|
Domain Number 1 Region: 97-343
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.18e-35
Family Alanine racemase-like, N-terminal domain 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|320100688|ref|YP_004176280.1|
Domain Number - Region: 545-582
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0732
Family Eukaryotic ODC-like 0.011
Further Details:      
 
Domain Number - Region: 453-522
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.0753
Family Eukaryotic ODC-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100688|ref|YP_004176280.1|
Sequence length 601
Comment arginine decarboxylase [Desulfurococcus mucosus DSM 2162]
Sequence
MLNTITLVWVYDREMSSSEWSLDVARELWGLNHSIRGDTITVDDEGYLAISIGGSSVRIK
DVMEKYGFDVAYIRVLPLIGKAMRLVYETFTELARIHGFKGGLQPVFPMKVNPIDIVIDA
IWRYGEKYGWGFNTGSIGELELLSKYAGKGPRILVYDGVLSDNVARILEGFREKGWRVVV
DVESEHDLDILSKHPELEVGLRIKPLFKPGGKWAHSAGLEGKFGLTVNTLVKLREEYKWI
EERARLLHVHAGSQIYKWSDVEAFINEVYNIYVQLTANGFSRLELVDPGGGLAYPYLDTR
SGSIESPDYTVVDYFNHMLRVFSRLDKHPVLVYEGGRYIVAAHRIVVAKVVDVRPYSAEQ
LSSTGTSVVEDVLRGVRTIRDLKAVLKEYRRLIHRGSQGQQYTLEERELAEDLVSKIREE
VVLKLSELLRAEPSSVDEVINDPFLYKLATSPSKRYILNLSIFADIPDSVLVNQYFQVAP
VQRLNEKPDVVAVLGDLTCDSMGEIGEYVSHVRMHVKADDWFTRMDLRLVMAPYKRLKLG
GVPLHLPVKGENYYVAILDTGAYQDPLTMKHNLIYGAPEIIMDEVDGEPKIEVVERNGKY
L
Download sequence
Identical sequences E8R8H2
gi|320100688|ref|YP_004176280.1| WP_013562020.1.43297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]