SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320100739|ref|YP_004176331.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100739|ref|YP_004176331.1|
Domain Number 1 Region: 110-212
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.0000131
Family Band 7/SPFH domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100739|ref|YP_004176331.1|
Sequence length 331
Comment hypothetical protein [Desulfurococcus mucosus DSM 2162]
Sequence
MSRRTNVIEWVNPGPDDILWVYPYEDIRWGSVVVVHEYEAAVFMRDGKIYDVLPPGRHTI
TTQNIPLLTRAYNLVMGYGETPFKARIVFISLKQFKGRFGTSTRVKLGPRTLYMTELQAY
GEYWFRVADPVLFLTQVAGAVPELSTPAVTEFLRGLFTEQFIQELANYTAIDVYTRLTEV
TTRIKTGTIYEALKQRGIELIDVKIGGVSLPQLEKMEKEDPTYGLPLLLAIQKGEEDKVL
EIIRTVETMRALGRSPGVGVLGALVALPQMLPQTMAPQVQQQPQQPQVQQPQQKSPTDKL
RELKKMLDEGLITREEYEQLKKEILEEFKRS
Download sequence
Identical sequences E8R8M3
gi|320100739|ref|YP_004176331.1| WP_013562071.1.43297 WP_013562071.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]