SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320100877|ref|YP_004176469.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100877|ref|YP_004176469.1|
Domain Number 1 Region: 5-285
Classification Level Classification E-value
Superfamily Folate-binding domain 4.87e-66
Family Aminomethyltransferase folate-binding domain 0.0000128
Further Details:      
 
Domain Number 2 Region: 279-368
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 4.41e-24
Family Aminomethyltransferase beta-barrel domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100877|ref|YP_004176469.1|
Sequence length 369
Comment aminomethyltransferase [Desulfurococcus mucosus DSM 2162]
Sequence
MPRIPLLEYYVEKGAETGLFGEWEVPYRYTNAIEEHISVRTSVGLFDVSHMGRVLLKGPD
VLPLAQYVYTKDISRTKEYSMSGPTLALNQWARVKDDEMLYKISDEEWLLVTNALTREHM
LSYLEKVRSEKGFRVEIVDLTFNYSMLALQGPRAVEVMESLGAKWAGDLKTLEFRMNEEI
QGVRTFLVSRSGWTGEDGFEIWGESGELKRLVDLFLSKGVKLAGLIARDTLRIEMGFVLG
GHEYGEDPTRFPCALSLRYGLGAITWEKKGFVGEEALKACRREGVRWIRVGLKLGKEAGR
HFPRQDAGVYSEDVWVGWVTSGTYSPVLNRGIAMAYVDSRYALFGEELTVDIRGKRYPAK
IVDFPFIKK
Download sequence
Identical sequences E8R911
gi|320100877|ref|YP_004176469.1| WP_013562209.1.43297 WP_013562209.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]