SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320100884|ref|YP_004176476.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100884|ref|YP_004176476.1|
Domain Number 1 Region: 54-187
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 8.63e-43
Family Band 7/SPFH domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100884|ref|YP_004176476.1|
Sequence length 262
Comment hypothetical protein [Desulfurococcus mucosus DSM 2162]
Sequence
MDPFGLLILLIIILFIGVPLLSASVKIVREYERVVVFRLGRLVGAKGPGLILVIPFFDQV
AKVDLRVITVDVPKQEIITKDNVSVKVDAVVYYRVVDPVLAITRVANYHYSVSLLGQTVL
RDVLGQSELDELLQKRDELNKRITGILDELTMPWGIKISSVTIKSVELPEELMRAMAKQA
EAERWRRARVIEAEGERQASQILAEAARMYEEHPVALRLRELQTLIEIAREKALVVVTES
SASSTGSMIGVYKALKEREKGE
Download sequence
Identical sequences E8R918
WP_013562216.1.43297 WP_013562216.1.60640 gi|320100884|ref|YP_004176476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]