SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320100885|ref|YP_004176477.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100885|ref|YP_004176477.1|
Domain Number 1 Region: 214-290
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000889
Family Multidrug resistance efflux transporter EmrE 0.009
Further Details:      
 
Weak hits

Sequence:  gi|320100885|ref|YP_004176477.1|
Domain Number - Region: 42-138
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00811
Family Multidrug resistance efflux transporter EmrE 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320100885|ref|YP_004176477.1|
Sequence length 292
Comment hypothetical protein [Desulfurococcus mucosus DSM 2162]
Sequence
MPLGDMATGLLYLGLSVLMWSLTPSLISMDKARYNSFTANGLRALLAGVVMLPFTAEIIL
ENPVDYLTAGALLGLIGILVGDSLYILTIRRLGPGLAVVLCYSYVATTQLLKQLVAPGGS
VYVAVAASLIAIVGMYIAVREQLTFIVFNTTGLLAAALTNISWAAWSLISWIYVKGRGLN
VLALTSARFIIPGLILTVYSTRRHGARELFTHAPRKLRYTMLSGLTGYLVGGTAYLESLK
YIDVSQATIATAAVPVLSQLISSTTTGSRIRRSELAGALLVALSIVISSLYS
Download sequence
Identical sequences E8R919
gi|320100885|ref|YP_004176477.1| WP_013562217.1.43297 WP_013562217.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]