SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320100977|ref|YP_004176569.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320100977|ref|YP_004176569.1|
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.31e-26
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.002
Further Details:      
 
Domain Number 2 Region: 145-249
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 3.66e-16
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320100977|ref|YP_004176569.1|
Sequence length 258
Comment molybdopterin dehydrogenase FAD-binding protein [Desulfurococcus mucosus DSM 2162]
Sequence
MIRDRRIPVPRFLVDLSPLKKDLSYVKIENGVVRIGALTTLWEISRSTLHRDIRYAGFTD
VFKKFGTMAIRFNATIGGNIASATQYSDYITLLLVYDARLRLESASGVREVSLEEFLVDK
RTTIIKPNELITEISFREPPSGTSSAFIKFDRRELIIAGIVTGAFYLTKEGERVKDVRIA
FDMVKERRIPGRARMTEECVIGKTLSESVLREAESCLEREMKRISDWWTSDEYRLDMSKT
SLRRGLLLAEKRISSGVI
Download sequence
Identical sequences E8R9B1
gi|320100977|ref|YP_004176569.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]