SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320101048|ref|YP_004176640.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320101048|ref|YP_004176640.1|
Domain Number 1 Region: 2-232
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 6.94e-65
Family Purine and uridine phosphorylases 0.00000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320101048|ref|YP_004176640.1|
Sequence length 240
Comment purine phosphorylase family protein [Desulfurococcus mucosus DSM 2162]
Sequence
MPVHIKASPGEIAENTIAVGDPGRVDLLSGILEDARVVNTHRGLKTVTGFYKGKRVTIAT
HGIGAPSASIVFEELYQLGARRIVRVGTTGGIRRDTRIGDVVVATGAMYVQNGCGLGQYI
PGLCGASSPDPVLTTRIMEALSKNGLNFKKGPVFSSDAFYAEDPSFAEKMSHYGVVAVEM
EAAALFTLGWMRGFDTSCVLVVSDVLHGEEAMKKYLTTEELAEVFLKIGKTIMDVFHDYY
Download sequence
Identical sequences E8R9I2
WP_013562380.1.43297 WP_013562380.1.60640 gi|320101048|ref|YP_004176640.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]