SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320101053|ref|YP_004176645.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320101053|ref|YP_004176645.1|
Domain Number 1 Region: 4-204
Classification Level Classification E-value
Superfamily HAD-like 1.42e-29
Family Phosphoserine phosphatase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320101053|ref|YP_004176645.1|
Sequence length 224
Comment phosphoserine phosphatase [Desulfurococcus mucosus DSM 2162]
Sequence
MPSGLVVFDCDGVLTENHSSWQVLHEYFGSRDNKYFADLYRRGLISYLDWMKIDIALMIH
SWGKPITRVNVEDALSRVKVKPEARRVVEALNEMGYIVAVVSSGIDVLVERVCREVGVDL
CFYNKLRFEDGELVPGGEALVPLREKPRVIRSIAENLSIRISDTYYVGDSEWDIDVFRSV
GHSIAVEPCGEACRHAEQVVSSLREIPDALRRIHGVGNQFSAGK
Download sequence
Identical sequences E8R9I7
WP_013562385.1.43297 gi|320101053|ref|YP_004176645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]