SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320101086|ref|YP_004176678.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320101086|ref|YP_004176678.1|
Domain Number 1 Region: 111-387
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 9.27e-77
Family NadC C-terminal domain-like 0.000000359
Further Details:      
 
Domain Number 2 Region: 3-114
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 3.93e-32
Family NadC N-terminal domain-like 0.0000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|320101086|ref|YP_004176678.1|
Sequence length 392
Comment Nicotinate phosphoribosyltransferase [Desulfurococcus mucosus DSM 2162]
Sequence
MGFYIAREEEILGGLATDVYFTRTFKVLKAKGVRKKVRMEFHVMKLPKGYEWAVYAGLEE
VIYLLKGKPVTVYSMPEGTLFKAGEPLLIIEGYYDDFALYETPVLGILRHYSSIASKAAR
VKRLAMDKTILFFGLRAVHPAIAPMVDRAAYIGGVDAVSGVLSEKYLGLKPSGTMPHALI
LTFGDQREAWKAFDEVVEPNVPRIMLVDTLYDEREEALMAARLLGGRLYGVRLDTPSSRR
GDMKHIVEEVRWTLDINGFKNVKIVVSGGLDEKEIVRLRDLVDAFGVGTSISMPPSVDIS
ADIVEVYENGAWKPFTKRGKLPGAKQVYRKRPGLNDIVALMDNPGNIPEDYTPLLLKYLD
NGEPVRELPSLEDIRRYVLEQLREVPEPTLAD
Download sequence
Identical sequences E8R9M0
gi|320101086|ref|YP_004176678.1| WP_013562418.1.43297 WP_013562418.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]