SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|320101338|ref|YP_004176930.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320101338|ref|YP_004176930.1|
Domain Number 1 Region: 23-164
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 9.89e-31
Family Hypothetical protein MJ0882 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320101338|ref|YP_004176930.1|
Sequence length 193
Comment 16S rRNA m(2)G 1207 methyltransferase [Desulfurococcus mucosus DSM 2162]
Sequence
MTHYYKPGPPGEKRLIPLTIHGQSFEFLSYTSLFSGSSIDEGTRLLLENIVIPEEGVVLD
IGCGYGVIGIVVARLNPRLKVYMTDVNPLAVKTARFNARRNGVGDRVVVVEGDGYRPVEG
LVFNAIYSNPPLAAGMRVVEEIVLGAKEHLAEEGFAQFVLARGGSHLAEKAKGKYRVVEA
KSKKGYILLYLKP
Download sequence
Identical sequences E8RAL2
WP_013562670.1.43297 WP_013562670.1.60640 gi|320101338|ref|YP_004176930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]