SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320101363|ref|YP_004176955.1| from Desulfurococcus mucosus DSM 2162

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320101363|ref|YP_004176955.1|
Domain Number 1 Region: 470-602
Classification Level Classification E-value
Superfamily vWA-like 0.000000000000417
Family RoRNP C-terminal domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|320101363|ref|YP_004176955.1|
Sequence length 635
Comment VWA containing CoxE family protein [Desulfurococcus mucosus DSM 2162]
Sequence
MNYSVSVEELRRLVDEGVRRELEALGARLAEFRCAGVDKLVLYAKMRLAIALLAGRNVAD
SLDGELVESLGLTRAARTPPPPAAELFQIDEGVWRRLAKTRYTTSRSLLTESSSRRGILT
YIWMRKTGILRRHPNGSLIVDRRELSRHPAGSERELGLGDIGRFLAEVPSSLWSKVITEE
LLGNAGLGDLITLAERYHGFDQRVDERLASEVRRRIAKGWVPSPEEARRLEGVIAKALKG
LKTTVPPHLLPFIDSVEDYVKGREGELAGEIERLPLRERWEVLRSLRRRIRDPGFFKHLN
PISLAELRSLGSVDRELASRVMLGQAIGSYLEYLLTRDPSFQAYAVHIAERIDAGALEPR
HRPLLESILNGDEKKMLFLLGREAGFDALELLSVKLGEEYSRSGGLDPAVVKRAIAIGMR
LLNYMRGGRGFTWRRRKTSVRGRLEVRGTLYKWVRLDNEAVFKRRERVQRVIGVVDVSGS
MARFAVWSMLSIAAVFPVVSHIVLFSEKPHVYRSPFKKTSLVLARFLEKLYTEGFKGYTN
ISEALRRAGELASRADSKTILVFSDLKQTVPDTEPWLVARWLVEKGLRVILVVPRGTESA
TVERYRGAGCDIVVVENPEDIPNILKRRINLKNRV
Download sequence
Identical sequences E8RAN7
gi|320101363|ref|YP_004176955.1| WP_013562695.1.43297 WP_013562695.1.60640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]