SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327313466|ref|YP_004328903.1| from Prevotella denticola F0289

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327313466|ref|YP_004328903.1|
Domain Number 1 Region: 372-569
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.17e-35
Family ABC transporter ATPase domain-like 0.00039
Further Details:      
 
Domain Number 2 Region: 23-296
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 7.06e-20
Family DNA repair protein MutS, domain III 0.013
Further Details:      
 
Domain Number 3 Region: 827-901
Classification Level Classification E-value
Superfamily SMR domain-like 0.0000000432
Family Smr domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|327313466|ref|YP_004328903.1|
Sequence length 902
Comment MutS2 family protein [Prevotella denticola F0289]
Sequence
MIYPKNFEQKIGFTEIRTLLRERCLSPLGKERVDEMSFSTDAGQINTWMEEIREFRRIQE
GQDDFPLDNFFDVRESVSRIRLEGTHMEVEELFDLKRSLETIIAIVSFLSRGEETEQGEI
RHYTPALYALADGIATFPILVQRISQIIDKFGKMRDNASPDLLQIRRELSQTEGSISRTL
YSILHSAQAEGLVEKDVSPTLRDGRLVIPVAPGLKRRISGIVHDESATGRTVYIEPSEVV
EANNRIRELENEERREIIRILTEFAKKMRPNVPEILDSYSLMAAVDFIRAKAELARLFRS
FEPEVSDKPHIDWIRAVHPLLQLSLERKSRKDANRLSLTDNSHADKDSNDEISLQEDNIL
SEEEYKTGNVPPSVVPLDIQLTKDKHLLIISGPNAGGKSVCLKTVGLLQYMLQCGLSIPV
GDRSTTGIFTDIMIDIGDEQSIENDLSTYSSHLMNMKIMMRHATEHTLILIDEFGTGTEP
QIGGAIAEAVLRQFWKKHVWAVITTHYQNLKHFAENHPGTANGAMLYDRHEMRPLFQLAI
GRPGSSFAIEIARKTGIPEEVIHDAADIVGSDYIQSDKYLQDIVRDKRYWESKRQTIHSH
EKELEKRIAQYEKDIATLEQSRKDILRRAKEQAEEIIKESNRRIENTIREIREKQAEKEE
TKRIRQELAAYEEGLQSSSQLDKPGKNNKKKMKDSGLLSDEDFQKKVDKIKSRKERHEQH
LKERAGKQQAAAEALKNAVRKQQTSGVVNVGDAVRIKGLTTIGKVEAIDGKQATVIFGDM
RTKMAMSRLEHVDAASLQTEQQQFQAYNYSRETRETIDKHRNQFHQELDVRGMRADEALN
QVQYFIDDAILVGAGQVRILHGKGNGILRQLIRQYLASIPNVKSYRDEHVQFGGAGITVV
EL
Download sequence
Identical sequences F2KZ87
WP_013671235.1.94677 gi|327313466|ref|YP_004328903.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]