SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|327314588|ref|YP_004330025.1| from Prevotella denticola F0289

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|327314588|ref|YP_004330025.1|
Domain Number 1 Region: 7-226
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.07e-50
Family PP-loop ATPase 0.0000626
Further Details:      
 
Domain Number 2 Region: 367-450
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000146
Family B3/B4 domain of PheRS, PheT 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|327314588|ref|YP_004330025.1|
Sequence length 456
Comment tRNA(Ile)-lysidine synthetase [Prevotella denticola F0289]
Sequence
MLNKVRRFIAFEHLLQADRLYLVALSGGADSVCLLLCLKELGYRIEAVHCNFHLRGEESQ
RDEQYCQELCVRENIPLHKAHFDTKTYAAQHKVSIEMAARSLRYRYFFQLKETLAADAVC
TGHHKEDSVETILINLVRGTGLNGLMGIRPRKGGVVRPLLCVTRQEIEQYLRSRSVSFVT
DSTNLVDDVVRNKIRLNILPQLAEINPSVNDAVLTAANHLSEVDAIVRDSLNMALDKAVR
PIGSTGPGNSFYPLEHTFKIDLKVVRHFPSPAYLLFHILKPLGFTPSQIAEVTAHLEGQP
GQVWASSTHELTHDRDSLLVMPVVAEKPRELIIPETGRYVYDDGLSIRLTKENRSPASSP
SFSRNPAIVDLDASSIRFPLTLRRTAEGDRFMPLGMSGTQLVSDFLTNLKRNRFEKRSQL
VLLDASGVILWLLGLRISECFKVSSHTTSCLHIELL
Download sequence
Identical sequences F2KYX5
gi|327314588|ref|YP_004330025.1| WP_013672138.1.94677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]