SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|320115885|ref|YP_004186044.1| from Thermoanaerobacter brockii subsp. finnii Ako-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|320115885|ref|YP_004186044.1|
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.96e-31
Family YheA-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|320115885|ref|YP_004186044.1|
Sequence length 109
Comment hypothetical protein Thebr_1085 [Thermoanaerobacter brockii subsp. finnii Ako-1]
Sequence
MNVYDKAYELANAIRQLPEYKAFKGAYQKINENEQNKKMLEDFRKKQLEIQAKELSGEKV
DPKEKEVLEKLWEILNLNPEISSYLSLEYALGKIMDDILKIIMEPMEMK
Download sequence
Identical sequences B0K0Q7 B0K9A0 C7IUH1 E8USD2
gi|320115885|ref|YP_004186044.1| 340099.Teth39_1058 399726.Teth514_1495 gi|167040133|ref|YP_001663118.1| gi|167037471|ref|YP_001665049.1| WP_003868470.1.26562 WP_003868470.1.2934 WP_003868470.1.47445 WP_003868470.1.56562 WP_003868470.1.81593 WP_003868470.1.95568 gi|307724548|ref|YP_003904299.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]