SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313124090|ref|YP_004034349.1| from Lactobacillus delbrueckii subsp. bulgaricus ND02

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313124090|ref|YP_004034349.1|
Domain Number 1 Region: 9-264
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-84
Family Protein kinases, catalytic subunit 0.00000206
Further Details:      
 
Weak hits

Sequence:  gi|313124090|ref|YP_004034349.1|
Domain Number - Region: 506-566
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.000641
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0095
Further Details:      
 
Domain Number - Region: 355-416
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00366
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 
Domain Number - Region: 424-477
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00719
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313124090|ref|YP_004034349.1|
Sequence length 668
Comment serine/threonine protein kinase with beta-lactam (pasta) domains [Lactobacillus delbrueckii subsp. bulgaricus ND02]
Sequence
MINKGYLLGDRYRIVDTLGEGGMANVYLADDIILKRQVAVKIIRLDLQKDSQVLARFQRE
ALATSELSHPNIVSVFDVGTDHGLPYMVMEYVKGPDLKDYIRENSPIPLPQVIKIMDQIL
SAMELAHKHNVIHRDLKPQNILMDEKGNIKIADFGIAVALNQSAITQTNSVLGSVHYMSP
EQTRGGMVTKQSDIYSLGIILYEALTGHVPFNGETPVAIALKHAEDDIPSLRKQNKAIPQ
ALENVVLKATAKDPRDRYASVAEMKADLDSSLDPSRAGEAIYRPSHGNNDETKILPALNG
KVMQAEKAKEGKAEETKKRSFWASIKKYKWWWIGSLFPVFAILLFMFLAVGHNNVRVPDV
VNMTEKAAKTSLKSSGLAVGAVKRTYSSDVKKGKVISTTPKANSPVDKGEKVNLLVSKGP
NLTKVPDVEGLYLSTAKKKLNKLGFKVKSREASSNEYLPGLIISQSVKAGRKVDASKTTI
TLVVAVALEDQPKPSSSSSSKKATFKLADLTGKSLEDAQSYAKSKKLNVKVEKDHSDSVD
SGDVISTDPAAGSEVSEGDTLTITVSKGAEKKEVKKTFTVDYQAAESSSSSSESSSSSSS
SQGNHVRIYIQDDNHSLGNIYRDLYITKDTDFTITFSVTKGDGKIKIVRDDQTVVDETIS
ADDSESGN
Download sequence
Identical sequences E4SVA7
gi|313124090|ref|YP_004034349.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]