SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333906640|ref|YP_004480226.1| from Marinomonas posidonica IVIA-Po-181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333906640|ref|YP_004480226.1|
Domain Number 1 Region: 17-87
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000159
Family RpiR-like 0.043
Further Details:      
 
Domain Number 2 Region: 104-266
Classification Level Classification E-value
Superfamily SIS domain 0.000000337
Family mono-SIS domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333906640|ref|YP_004480226.1|
Sequence length 289
Comment RpiR family transcriptional regulator [Marinomonas posidonica IVIA-Po-181]
Sequence
MKNTFSSKPEHIATTTSQRIQELIPLVSKSEARVAQFILLNLDHISYETGASIAEKAAVS
QITVSRFLKRAGYQGISALKEELQKELIPIEANESQRLAPDSFYKDNLKQELKSMVRLYE
QFETENWESLVSCVSAATRVYVTGFQSIRGTAEDFTRRLSLARDRVQYLSPHDGMLGEWL
EDSSRSRKGYDTLIILDVVPYASEVRKLCEVAVEKGIQIVIISDEFCHWASEYDAHIVYS
KSKSGLFLESTWGLVLTTNMLVDAVSRRDVNSDTRIKRWQEMAKRLDLF
Download sequence
Identical sequences F6CX53
WP_013794784.1.19944 gi|333906640|ref|YP_004480226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]