SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333906839|ref|YP_004480425.1| from Marinomonas posidonica IVIA-Po-181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333906839|ref|YP_004480425.1|
Domain Number 1 Region: 245-608
Classification Level Classification E-value
Superfamily SIS domain 2.23e-108
Family double-SIS domain 0.00000000178
Further Details:      
 
Domain Number 2 Region: 2-237
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.38e-75
Family Class II glutamine amidotransferases 0.000000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333906839|ref|YP_004480425.1|
Sequence length 608
Comment glucosamine--fructose-6-phosphate aminotransferase [Marinomonas posidonica IVIA-Po-181]
Sequence
MCGIVGAIARRNVSKILIEGLSRLEYRGYDSSGVAINNEEGVYFHRAVGKVQALRDKFSE
QPLDGKMGIAHTRWATHGKPTEANAHPHFSGDDLALVHNGIIENHEPLRRELKDKGYEFN
SETDTEVIVHLIHDALKTQPDLLKAVQSSLSRLEGAFAIGVVQKDDNERFIAARKGSPLV
IGVGIEENFVASDQLALLHVTDQFIFLEEGDVADVSRDQVTIYDIRGEVQERPVSVFNHN
VDATDKGEFRHYMMKEIYEQPNVISACLEGRISDSKVLTSCFGAESDFLKKVENIHIVAC
GTSYHAGMVAKYWIEELAGLPCSVEVASEYRYRKVAVPKNTLFLTLSQSGETADTLAALR
MAKELNYLTTLAICNVPSSTLVRESALTLLTNAGAEIGVASTKAFTTQLTALLITSVAIA
VENGLSAEKEKTLVQAMRSLPACVNEALQQDGHIKQIADKFANKHNALFLGRGAMFPIAL
EGSLKLKEISYIHAEAYPAGELKHGPLALVDEDMPIITLVPHNGMLDKIKSNLQEVAARG
GELYVFADRETDLHNEENITFSEVPKVEAILEPIVHTIPLQLLSYHVAVVKGTDVDQPRN
LAKSVTVE
Download sequence
Identical sequences F6CZ50
WP_013794983.1.19944 gi|333906839|ref|YP_004480425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]