SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333908010|ref|YP_004481596.1| from Marinomonas posidonica IVIA-Po-181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333908010|ref|YP_004481596.1|
Domain Number 1 Region: 120-278
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.07e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0003
Further Details:      
 
Domain Number 2 Region: 410-550
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.83e-38
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 9.65e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 
Domain Number 4 Region: 253-277,316-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.93e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333908010|ref|YP_004481596.1|
Sequence length 553
Comment ferredoxin--nitrite reductase [Marinomonas posidonica IVIA-Po-181]
Sequence
MYQYDAIDQQLVEERVAQFRDQTRRYLNEELSEQEFLPLRLQNGLYVQRYAPMLRIAIPY
GMLSSTQLRKLADISRRYDRAYGHFSTRQNLQLNWPKLEDVPDILAELADVQMHAVQTSG
NCIRNTTTDQYAGVISDEVVDPRPYCELIRQWSTFHPEFAFLPRKFKIAVNATESADRAA
TQVHDIGLHIKKNEAGEIGFKVIVGGGLGRTPMVGVTISEFVPREDLLTYLDAIIRVYNQ
QGRRDNKYKARIKILVKALGIEEFRRRVDAEWAHLRGSESTVPMSEFERLASFFTEPAYQ
SLVNQPEVLVSKLADSAGFARWYERNTFEHKQAGYRIVTLTLKKAGQAPGDATAEQMEKA
ANLADQFSFGELRVSHEQNLVLADVRQDQLIELWEAAKDAGFATPTLGLLTDMICCPGGD
FCALANAKSIPIAAQIQDTFSDLDYLYDLGNIDLNISGCMNACGHHHVGNIGILGVDKKG
EEFYQVSIGGASGHDASIGKILGPSFAQEEISGVIQKLMQVYVDNRSAEERFIDTFRRVG
IAAFKEAAYAKTN
Download sequence
Identical sequences F6CZE0
gi|333908010|ref|YP_004481596.1| WP_013796152.1.19944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]