SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333908554|ref|YP_004482140.1| from Marinomonas posidonica IVIA-Po-181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333908554|ref|YP_004482140.1|
Domain Number 1 Region: 113-274
Classification Level Classification E-value
Superfamily SIS domain 1.25e-25
Family mono-SIS domain 0.0038
Further Details:      
 
Domain Number 2 Region: 9-85
Classification Level Classification E-value
Superfamily Homeodomain-like 2.33e-18
Family RpiR-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333908554|ref|YP_004482140.1|
Sequence length 288
Comment RpiR family transcriptional regulator [Marinomonas posidonica IVIA-Po-181]
Sequence
MSAPNTLEQLQQTISRNYEGLSKRLQQVARFLLEHPNTVALETVASLAEQCGVPPSTLVR
FAAAFEYNGFSEMQNLFRQSLVEQTSISNYSERVKMNQNATGADIHADQILSEFSQRNAF
SMSHMPHQFSPEMLSSAVDLLENAENIYLIGLRRAFPISSYFAYSLRHLNKTTHLIDGGG
GMLVEQASNIRKDDVIIATTFSPYAQETVTVSEYAYAAGAKVIAITDSKISPLAGMSDVC
FDIKEAEVLGFRSLTSSMTLAQTLLVSLAYRLNADGQMGDTKQIAWNH
Download sequence
Identical sequences F6CUA2
gi|333908554|ref|YP_004482140.1| WP_013796696.1.19944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]