SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333909088|ref|YP_004482674.1| from Marinomonas posidonica IVIA-Po-181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333909088|ref|YP_004482674.1|
Domain Number 1 Region: 17-288
Classification Level Classification E-value
Superfamily SIS domain 6.9e-60
Family mono-SIS domain 0.0045
Further Details:      
 
Domain Number 2 Region: 269-323
Classification Level Classification E-value
Superfamily CBS-domain pair 0.0000000636
Family CBS-domain pair 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333909088|ref|YP_004482674.1|
Sequence length 324
Comment KpsF/GutQ family protein [Marinomonas posidonica IVIA-Po-181]
Sequence
MSAPTSLNTDTDALIASAQRTLSTQAQALANLASQVTEEFAKAVRMILDSKGRTIICGMG
KSGLIGKKIAATLASTGTPSFFLHPGEAFHGDLGMIQAEDTLILISYSGETEELMRLLPS
LQSFGNPSIALVGNMDSTLAKHCDCVLDISVDRETCPNNLAPTTSTTMTTAMGDALAVAL
MECRAFQPHDFARFHPGGSLGRKLLTRVKDIMHKQGLPVCSPSTNLKDAISVMTQGRKGV
VLVQQEDTLLGIFTDGDLRRAMLKDSDGMMHKNIADLMTLNPKTINENVMIVEAEEQMLR
DKITLLVVVNDDQKVSGILEIYDR
Download sequence
Identical sequences F6CYS3
WP_013797227.1.19944 gi|333909088|ref|YP_004482674.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]