SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333909466|ref|YP_004483052.1| from Marinomonas posidonica IVIA-Po-181

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333909466|ref|YP_004483052.1|
Domain Number 1 Region: 5-78
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000627
Family RpiR-like 0.014
Further Details:      
 
Domain Number 2 Region: 92-263
Classification Level Classification E-value
Superfamily SIS domain 0.0000000247
Family double-SIS domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333909466|ref|YP_004483052.1|
Sequence length 272
Comment RpiR family transcriptional regulator [Marinomonas posidonica IVIA-Po-181]
Sequence
MTTKQDVLSLIEKNYPSLSSSARVIANYLQQHPLAIVSQTSAEIADNTNTSKATVSRFFR
QLGYDSHQSAKQAQLALRESGVPIFTQGTSLDQTEQELKNLSLTFEGLRPETLNDISASL
ANASRVTLIGFRNAYPLALHFRQQLQQVRHSVRLLPQPGQTLGEDLQDILEDEVIVLLGF
RRRTRQFKQIVDLLEGRSTVLITDPTGQIYNQQVSHVLLCHLGNESPFDSYAAPMSLISM
LCNRVYACLGDEARKQTKEIASLYETLNELEP
Download sequence
Identical sequences F6CS26
gi|333909466|ref|YP_004483052.1| WP_013797603.1.19944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]