SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|312110001|ref|YP_003988317.1| from Geobacillus sp. Y4.1MC1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|312110001|ref|YP_003988317.1|
Domain Number 1 Region: 27-99
Classification Level Classification E-value
Superfamily Colicin 0.0000235
Family Colicin 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|312110001|ref|YP_003988317.1|
Sequence length 252
Comment hypothetical protein GY4MC1_0892 [Geobacillus sp. Y4.1MC1]
Sequence
MRRFCLFFSLALIFILNSIPISVFAYSYGDPNEEKVAEAYKQMAEKLNEQPPNFAEACAI
FETVKEEIDMHMGKEPSQAVLAALDKKDKEAVLKNMEKILVLNIARRLENIEKNFEQYDT
SKRLLAKAFATYEALSPMVQGKDAALDKRLRDEFNKALQSLGNPGLFGVGEKETDIEQFK
KSKETILTSLQKHFGLKSLKVGHFSESATEKPQEVQKKEWTDLSKLKNWIPIAILVVVIA
GVVVYSWRRKRT
Download sequence
Identical sequences A0A0F6BJV5
WP_013400280.1.100411 gi|312110001|ref|YP_003988317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]