SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220154|ref|YP_007104324.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220154|ref|YP_007104324.1|
Domain Number 1 Region: 104-318
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.47e-58
Family BC ATP-binding domain-like 0.00000473
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.01e-34
Family BC N-terminal domain-like 0.0000506
Further Details:      
 
Domain Number 3 Region: 329-420
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.15e-26
Family BC C-terminal domain-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428220154|ref|YP_007104324.1|
Sequence length 432
Comment phosphoribosylamine--glycine ligase [Synechococcus sp. PCC 7502]
Sequence
MKVLIVGSGGREHALAWKFAQSEKVTQILCIPGNGGTATMPKCQNLSFAVSDFEGIRRFA
SVQGVALTVIGPELPLAMGIVDYFHDANLPVFGPTQVAAQIESSKSWAKELMISAGIPTA
ASATFTDPELAKAYVRSQSIPIVIKADGLASGKGVTVATTLDQALGAIEQMFTGQFGTAG
ERVLIEEYLAGQEVSILAVTDGDTIRPLLPAQDYKRLKEGNLGPNTGGMGAYAPSVITTP
QLMAEIQTTILEPTIAALRDRGINYCGCLYAGLMITPEGKPKVIEFNARFGDPETQAILP
LLNSPLEDLLLACVEKRLGQFLPISWKPGSSVCVVMTSAGYPETTESGKLISGIKKAEEN
GAAVFQAGTKIKDKSLVTNGGRVLGVSATGKELNEAIATAYRAVSHISYDGANYRRDIGV
IEVPKVLNIKSP
Download sequence
Identical sequences K9SQX7
gi|428220154|ref|YP_007104324.1| WP_015166848.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]