SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220156|ref|YP_007104326.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220156|ref|YP_007104326.1|
Domain Number 1 Region: 5-229,424-671
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.1e-150
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000057
Further Details:      
 
Domain Number 2 Region: 229-423
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 5.02e-55
Family ValRS/IleRS/LeuRS editing domain 0.00000203
Further Details:      
 
Domain Number 3 Region: 666-853
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.48e-35
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428220156|ref|YP_007104326.1|
Sequence length 854
Comment leucyl-tRNA synthetase [Synechococcus sp. PCC 7502]
Sequence
METSKYNPQTIEPKWQQIWKEQQLDQTPEPSDDRPKFYALSMFPYPSGSLHMGHVRNYTI
TDAIARFKRMSGYRVLHPMGWDAFGLPAENAAIDRNTHPATWTFQNIEQMRSQLKQIGLS
YDWDRELATCAPDYYHWTQWLFLEFLGAGLAYQKEATVNWDPIDQTVLANEQVDSDGRSW
RSGAKVEKRKLRQWFFKITDYADRLLQDLDQLPHWPERVKTMQANWIGKSIGAELTFPIV
QPSETAAKITVFTTRPDTIYGVSYVVLAPEHPLVKEITTAEQKDQVEAFITAVASISEID
RTAEDKPKQGVFTGGYVINPFTNQEVPIWIADYVLLEYGTGAVMGVPAHDVRDFAFAKQY
GLPIQQVIISNSQTEVKELKSAYTETGIMIQSDRFNGLDSVTAKTKIIEYAEANNWGKAR
IQYRLRDWLISRQRYWGCPIPIIHCPDCGIVPVPDQDLPVELPENVELTGRGGSPLAQLS
SWVNVKCPKCGTHAKRETDTMDTFIDSSWYYLRFTDAKNPKEAFTKAKVNDWMSVDQYVG
GVEHAILHLLYSRFFTKVLSDRHLLNFNEPFQRLLTQGMVQGLTYSNPKKEGKDKWISST
LVNPADPRDPETGEPLEVGYATMSKSKGNGVSPQQVIEKYGADVMRMFVLFKAPPEKDLE
WDEADVEGQWRFLNRIWRLVTEFVEAQPKITDIPDKNLKRAIHTAIKEITEDLTGDYQLN
TAISELMKLSNALQDSSDKASFTFKEGIETLLILLAPFAPHIACELWSMLGYQNTILTHK
WLVHDPNALIVDEITLVIQINGKVRGSIQVPSGADKTALEEYARNSEVAQKYLEGKEIKK
AIAVPGKLVNFVIL
Download sequence
Identical sequences K9SQE3
WP_015166850.1.58188 gi|428220156|ref|YP_007104326.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]