SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220178|ref|YP_007104348.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|428220178|ref|YP_007104348.1|
Domain Number - Region: 5-109
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0445
Family DNA repair protein MutS, domain III 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428220178|ref|YP_007104348.1|
Sequence length 112
Comment hypothetical protein Syn7502_00038 [Synechococcus sp. PCC 7502]
Sequence
MNDLQTQIFELRDQLRHLNHVIEAMPKQIIAALVSNGITNEASSINRLQRETLEYSFAHK
DIIDEDNAHVCQGDQQIPCEWQLGRLSAQLTYAYERIAALEKQLLSRHLSNR
Download sequence
Identical sequences K9SPU7
WP_015166872.1.58188 gi|428220178|ref|YP_007104348.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]