SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220185|ref|YP_007104355.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220185|ref|YP_007104355.1|
Domain Number 1 Region: 396-510
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.61e-18
Family Heme-binding PAS domain 0.039
Further Details:      
 
Domain Number 2 Region: 676-779
Classification Level Classification E-value
Superfamily PP2C-like 0.0000785
Family PP2C-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428220185|ref|YP_007104355.1|
Sequence length 781
Comment PAS domain-containing protein [Synechococcus sp. PCC 7502]
Sequence
MNPLKPATTLMNNLKYPQKFLVISLIFSLPMVLMLYLLVTEINSRVEFARKEIIGNQYLR
SLNQVWKYTLQGKVAIQDKDSNFNQSQIAESLKNLESVNQSLESKLQTTEIYRELTDVTK
TLSKIDNSQNAFIYQIQINTIKKLRSQVGDTSNLILDPDLDTYYLMDTTLLRLPAIQQIL
TEIEFITRETSNRGFLTASEESRLNQLSALLKEQSQTLNTNLNNSFKNNPANNLSPKLGA
DLGKLLDNFKQISQDLDQAVAKNKTLSFTGIDIIKNSNQESFKFADKTLDQLDILLNYRI
NSFIHKQILISLFVVTILLVVAYLFVGFYQSVMQTVRCLDVAAKRMTNGNAGNLETISLD
TKDELGTVVEAFNRIAVALVEAINSARSSEVKYRSIFENAIEGIFQTSPQGEYVSVNPSL
VKMYGYDSADELISTCTNVEHQLYVDPHRRQDFVNLMAKNNQVIKFESEIYRKDRSTIWI
SEDARAVKNEQGELLYYEGSVRDISDRKAAEKSLQKANLSIILLNEQLKAENMRMSAELS
ISRRLQQMILPRDEELKQIKELDISGYMEPATEVGGDYYDILVEDGGKIKIGIGDVTGHG
LESSVLMIMVQTAVRTLLVNNETDPIRFLNTLNRTIYDNAQRMESGKNLTLSLIDYECGK
FTISGQHEEMIIVRATGEVERIDTIDLGFPIGLEPHIGDFINKTEVELNENDVVVLYTDG
VTEAEDMEKEQYGIDRLCTVVLEHSHLSANDIRQAVIDNLRSHIGEQQVFDDITLLVIKQ
K
Download sequence
Identical sequences K9SQ04
WP_015166879.1.58188 gi|428220185|ref|YP_007104355.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]