SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220211|ref|YP_007104381.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220211|ref|YP_007104381.1|
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 4.06e-38
Family N-terminal domain of MutM-like DNA repair proteins 0.00035
Further Details:      
 
Domain Number 2 Region: 136-226
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.44e-31
Family Middle domain of MutM-like DNA repair proteins 0.0022
Further Details:      
 
Domain Number 3 Region: 226-277
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.38e-16
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|428220211|ref|YP_007104381.1|
Sequence length 279
Comment formamidopyrimidine-DNA glycosylase Fpg [Synechococcus sp. PCC 7502]
Sequence
MPELPEVETVRRSLHESTCDRQIISSEILLERTIAYPHNPEEFNLGLKGKRILSWHRRGK
YLLAELSNDSWLGVHLRMTGKLLWCDRSLPIHTHTRIRIYFANQQELRFNDQRTFGQMWL
VPSGINPEEIISGVQKLGMEPFDPNFNYEYLQNKLRKSDRPIKNSLLDQTVIAGIGNIYA
DESLFLSGIHPQTKSNQLTKSQLESLVQAIRRVLSDGITHGGTTFSDFVDIGGDKGNYIH
SAWVFRRTGQPCKVCSGVIARIKLGGRSTHFCPKCQPIS
Download sequence
Identical sequences K9SQK7
gi|428220211|ref|YP_007104381.1| WP_015166905.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]