SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220215|ref|YP_007104385.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220215|ref|YP_007104385.1|
Domain Number 1 Region: 363-545
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.42e-63
Family Pyruvate oxidase and decarboxylase PP module 0.000044
Further Details:      
 
Domain Number 2 Region: 1-171
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.1e-53
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000245
Further Details:      
 
Domain Number 3 Region: 187-368
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.09e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428220215|ref|YP_007104385.1|
Sequence length 554
Comment thiamine pyrophosphate-dependent protein [Synechococcus sp. PCC 7502]
Sequence
MNTAELLVQCLENEGVKYIFGLPGEENMEVLNALEKSSIQFITTRHEQGAAFMADVYGRL
TGTAGVCLSTLGPGATNLMTGVADANLDCAPLVAITGQVGTDRMHIESHQYLDLVAMFAP
VTKWNAQIVRPSITPEIVRKAFKVAQSEKPGAVHIDLPENIAAMPVTGSPLHQSNDRDSD
RGKSGKIYASYHSLGEAAGLISKAKNPLVLVGNGAIRSYASDALTEFATQLNIPVVNTFM
GKGVIPYTHPLSLWTMGLQQRDFISYAFDETDLVIAVGYDLVEYSPKKWNASGAIPIIHI
SELAAEVDSSYIPKVEVVGDIADALNEIIHRCDRQGKPNPHALELRHSIKADYEQYAEDS
GYPVKPQKIVYDLRQVMGAEDIVISDVGAHKMWMARHYHCDRPNTCIISNGFAAMGIAIP
GALAAKLVYPERQVVAVTGDGGFMMNMQELETAVRLGLAFVTLIFNDGGYGLIEWKQQVH
YGKSAYIQFGNPDFVKLADSMGLKGYRIEAAADLVPTLKEALAQSVPTIIDCPVDYRENM
LFSRRSGSTTATTT
Download sequence
Identical sequences K9SQ33
WP_015166909.1.58188 gi|428220215|ref|YP_007104385.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]