SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220234|ref|YP_007104404.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220234|ref|YP_007104404.1|
Domain Number 1 Region: 125-294
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.31e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000307
Further Details:      
 
Domain Number 2 Region: 381-496
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-30
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000218
Further Details:      
 
Domain Number 3 Region: 3-122
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.74e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.0002
Further Details:      
 
Domain Number 4 Region: 265-397
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 3.11e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428220234|ref|YP_007104404.1|
Sequence length 518
Comment sulfite reductase subunit beta (hemoprotein) [Synechococcus sp. PCC 7502]
Sequence
MANKFEDLKSAKDGLDVKAELEHFAQIGWEEVPSDDLEHRLKWLGLFYRKSTPGKFMLRM
RIPSGILTSGQLRVLAEVVQQCGEDGVADITTRQNIQMRGIALSNVPEIFRKFSESGLTS
IQSGMDNVRNITASPVAGIDANELIDTRGLARKIQDMITNNGDGNKSFSNLPRKFNIAIA
GCRDNSVHAEINDIAFIPAYKGGEKGASIGFNVLVGGFFSIKRVAEAIPLNAWVDPRDVV
QLCEAILLVFRDHGLRENRQKSRLMWLIDEWGIAKFRDEVEKRLGYTLLPASPKDEIEWN
KRDHIGIHAQKQSGLNYVGLHVPVGRLYASDMFNLARMADVYGSGEVRLTVEQNIIIPDV
PDSRIGALLKEPLLQKFSAYPGNLFRALVSCTGIQFCNLAIIETKNRSLALVEALESELS
LPRPVRIHWSGCANSCGQPQVGDIGFIGCKARKNGVMVDAVDIYMGGEVGKDAHLGECVM
EKIPCEDLKDVVQKLLIENFGAVPKSRATVNKSELILV
Download sequence
Identical sequences K9SR84
gi|428220234|ref|YP_007104404.1| WP_015166928.1.58188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]