SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428220273|ref|YP_007104443.1| from Synechococcus sp. PCC 7502

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428220273|ref|YP_007104443.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 6.93e-45
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00056
Further Details:      
 
Domain Number 2 Region: 160-318
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.14e-30
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00049
Further Details:      
 
Domain Number 3 Region: 321-424
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 3.79e-27
Family Glutamyl tRNA-reductase dimerization domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|428220273|ref|YP_007104443.1|
Sequence length 431
Comment glutamyl-tRNA reductase [Synechococcus sp. PCC 7502]
Sequence
MNIAVVGLSHKTATVEVREKLSIPETRVESAIAQLNSLPSIEECAILSTCNRLELYIVTK
GTESGIREITQFLSEFSQLPLQFLRRHLFVLLRQDAVMHLLRVAAGLDSLVLGEGQILAQ
VKHTHRLAQQHGGSGRILNQLFKQALAAGKDVRTKTDIGTGAVSISSAAVELAQMKLDRL
ANQRITILGAGKMSRLLVKHLVSKGANKIAIVNRSAQRAQELVQEFQTEGVDFQIHGFEH
LCNCIEVSDLAFTSTASTEVLLSRQDLEPFIANHPGLMLIDIAVPRNVHSDVNDLPNVKA
FNVDDLQAVVAENQESRRQMALQAEVLLEESFLEFDAWWRSLDTVPTINKLRQKMEVIRE
QELEKALSRLGSEFAEKHQDVIENLTRGIINKILHDPMVQLRAQQDIEARKRAMQTLQML
FDLESGNKQTI
Download sequence
Identical sequences K9SQ56
WP_015166967.1.58188 gi|428220273|ref|YP_007104443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]